Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of WISP2 MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,IP |
More info about WISP2 MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00008839-D01 |
| Product name: | WISP2 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human WISP2 protein. |
| Gene id: | 8839 |
| Gene name: | WISP2 |
| Gene alias: | CCN5|CT58|CTGF-L |
| Gene description: | WNT1 inducible signaling pathway protein 2 |
| Genbank accession: | NM_003881.2 |
| Immunogen: | WISP2 (NP_003872.1, 1 a.a. ~ 250 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF |
| Protein accession: | NP_003872.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Immunoprecipitation of WISP2 transfected lysate using anti-WISP2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with WISP2 MaxPab mouse polyclonal antibody (B01) (H00008839-B01). |
| Applications: | WB-Ti,IP |
| Shipping condition: | Dry Ice |
| Publications: | Identification of novel adipokines in the joint. Differential expression in healthy and osteoarthritis tissues.Conde J, Scotece M, Abella V, Gomez R, Lopez V, Villar R, Hermida M, Pino J, Gomez-Reino JJ, Gualillo O. PLoS One. 2015 Apr 8;10(4):e0123601. |