| Brand: | Abnova |
| Reference: | H00008837-M01 |
| Product name: | CFLAR monoclonal antibody (M01), clone 2F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CFLAR. |
| Clone: | 2F12 |
| Isotype: | IgG2a kappa |
| Gene id: | 8837 |
| Gene name: | CFLAR |
| Gene alias: | CASH|CASP8AP1|CLARP|Casper|FLAME|FLAME-1|FLAME1|FLIP|I-FLICE|MRIT|c-FLIP|c-FLIPL|c-FLIPR|c-FLIPS |
| Gene description: | CASP8 and FADD-like apoptosis regulator |
| Genbank accession: | BC001602 |
| Immunogen: | CFLAR (AAH01602, 178 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYE |
| Protein accession: | AAH01602 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to CFLAR on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |