No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00008834-A01 |
Product name: | C17orf35 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant C17orf35. |
Gene id: | 8834 |
Gene name: | TMEM11 |
Gene alias: | C17orf35|PM1|PMI |
Gene description: | transmembrane protein 11 |
Genbank accession: | NM_003876 |
Immunogen: | C17orf35 (NP_003867, 128 a.a. ~ 192 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | FDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV |
Protein accession: | NP_003867 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (33.26 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |