Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NRP1 monoclonal antibody (M05), clone 1B3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about NRP1 monoclonal antibody (M05), clone 1B3
| Brand: | Abnova |
| Reference: | H00008829-M05 |
| Product name: | NRP1 monoclonal antibody (M05), clone 1B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NRP1. |
| Clone: | 1B3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8829 |
| Gene name: | NRP1 |
| Gene alias: | BDCA4|CD304|DKFZp686A03134|DKFZp781F1414|NP1|NRP|VEGF165R |
| Gene description: | neuropilin 1 |
| Genbank accession: | NM_003873 |
| Immunogen: | NRP1 (NP_003864, 22 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHG |
| Protein accession: | NP_003864 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NRP1 monoclonal antibody (M05), clone 1B3 Western Blot analysis of NRP1 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | EXTRACELLULAR AND MEMBRANE-ASSOCIATED PROSTATE CANCER MARKERSKlee, George G. ;Vasmatzis, George;Kosari, Farhad;Klee, Eric W. FreshPatents.com |