No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00008824-M01A |
| Product name: | CES2 monoclonal antibody (M01A), clone 2H7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CES2. |
| Clone: | 2H7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8824 |
| Gene name: | CES2 |
| Gene alias: | CE-2|CES2A1|PCE-2|iCE |
| Gene description: | carboxylesterase 2 (intestine, liver) |
| Genbank accession: | NM_003869 |
| Immunogen: | CES2 (NP_003860, 514 a.a. ~ 621 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHT |
| Protein accession: | NP_003860 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | CES2 monoclonal antibody (M01A), clone 2H7. Western Blot analysis of CES2 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |