No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00008819-M02 |
| Product name: | SAP30 monoclonal antibody (M02), clone 4D2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SAP30. |
| Clone: | 4D2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8819 |
| Gene name: | SAP30 |
| Gene alias: | - |
| Gene description: | Sin3A-associated protein, 30kDa |
| Genbank accession: | NM_003864 |
| Immunogen: | SAP30 (NP_003855, 131 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGV |
| Protein accession: | NP_003855 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoperoxidase of monoclonal antibody to SAP30 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.5 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |