No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00008819-A01 |
Product name: | SAP30 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SAP30. |
Gene id: | 8819 |
Gene name: | SAP30 |
Gene alias: | - |
Gene description: | Sin3A-associated protein, 30kDa |
Genbank accession: | NM_003864 |
Immunogen: | SAP30 (NP_003855, 131 a.a. ~ 219 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGV |
Protein accession: | NP_003855 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | SAP30 polyclonal antibody (A01), Lot # 051018JC01 Western Blot analysis of SAP30 expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |