No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00008814-M03 |
| Product name: | CDKL1 monoclonal antibody (M03), clone 1F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDKL1. |
| Clone: | 1F12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8814 |
| Gene name: | CDKL1 |
| Gene alias: | KKIALRE|p42 |
| Gene description: | cyclin-dependent kinase-like 1 (CDC2-related kinase) |
| Genbank accession: | NM_004196 |
| Immunogen: | CDKL1 (NP_004187, 259 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI |
| Protein accession: | NP_004187 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoperoxidase of monoclonal antibody to CDKL1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 5 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |