CDKL1 monoclonal antibody (M01), clone 5B11 View larger

CDKL1 monoclonal antibody (M01), clone 5B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDKL1 monoclonal antibody (M01), clone 5B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about CDKL1 monoclonal antibody (M01), clone 5B11

Brand: Abnova
Reference: H00008814-M01
Product name: CDKL1 monoclonal antibody (M01), clone 5B11
Product description: Mouse monoclonal antibody raised against a partial recombinant CDKL1.
Clone: 5B11
Isotype: IgG2a Kappa
Gene id: 8814
Gene name: CDKL1
Gene alias: KKIALRE|p42
Gene description: cyclin-dependent kinase-like 1 (CDC2-related kinase)
Genbank accession: NM_004196
Immunogen: CDKL1 (NP_004187, 259 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI
Protein accession: NP_004187
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008814-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008814-M01-3-2-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CDKL1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 5 ug/ml]
Applications: WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CDKL1 monoclonal antibody (M01), clone 5B11 now

Add to cart