No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00008814-M01 |
Product name: | CDKL1 monoclonal antibody (M01), clone 5B11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDKL1. |
Clone: | 5B11 |
Isotype: | IgG2a Kappa |
Gene id: | 8814 |
Gene name: | CDKL1 |
Gene alias: | KKIALRE|p42 |
Gene description: | cyclin-dependent kinase-like 1 (CDC2-related kinase) |
Genbank accession: | NM_004196 |
Immunogen: | CDKL1 (NP_004187, 259 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI |
Protein accession: | NP_004187 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to CDKL1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 5 ug/ml] |
Applications: | WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |