| Brand: | Abnova |
| Reference: | H00008813-A01 |
| Product name: | DPM1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant DPM1. |
| Gene id: | 8813 |
| Gene name: | DPM1 |
| Gene alias: | CDGIE|MPDS |
| Gene description: | dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit |
| Genbank accession: | NM_003859 |
| Immunogen: | DPM1 (NP_003850, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RKIISRGANFLTQILLRPGASDLTGSFRLYRKEVLEKLIEKCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT |
| Protein accession: | NP_003850 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | DPM1 polyclonal antibody (A01), Lot # 051214JC01 Western Blot analysis of DPM1 expression in PC-12 ( Cat # L012V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |