| Brand: | Abnova |
| Reference: | H00008807-A01 |
| Product name: | IL18RAP polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant IL18RAP. |
| Gene id: | 8807 |
| Gene name: | IL18RAP |
| Gene alias: | ACPL|CD218b|CDw218b|IL18RB|MGC120589|MGC120590 |
| Gene description: | interleukin 18 receptor accessory protein |
| Genbank accession: | NM_003853 |
| Immunogen: | IL18RAP (NP_003844, 20 a.a. ~ 129 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPK |
| Protein accession: | NP_003844 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IL18RAP polyclonal antibody (A01), Lot # 060104JC01 Western Blot analysis of IL18RAP expression in Y-79 ( Cat # L042V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |