DYRK4 purified MaxPab mouse polyclonal antibody (B01P) View larger

DYRK4 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DYRK4 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about DYRK4 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00008798-B01P
Product name: DYRK4 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human DYRK4 protein.
Gene id: 8798
Gene name: DYRK4
Gene alias: -
Gene description: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Genbank accession: NM_003845.1
Immunogen: DYRK4 (NP_003836.1, 1 a.a. ~ 520 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPASELKASEIPFHPSIKTQDPKAEEKSPKKQKVTLTAAEALKLFKNQLSPYEQSEILGYAELWFLGLEAKKLDTAPEKFSKTSFDDEHGFYLKVLHDHIAYRYEVLETIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHQQALMELKILEALRKKDKDNTYNVVHMKDFFYFRNHFCITFELLGINLYELMKNNNFQGFSLSIVRRFTLSVLKCLQMLSVEKIIHCDLKPENIVLYQKGQASVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYDVAIDMWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWIHQSRNLKPQPRPQTLRKSNSFFPSETRKDKVQGCHHSSRKADEITKETTEKTKDSPTKHVQHSGDQQDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNVLPPIV
Protein accession: NP_003836.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008798-B01P-13-15-1.jpg
Application image note: Western Blot analysis of DYRK4 expression in transfected 293T cell line (H00008798-T01) by DYRK4 MaxPab polyclonal antibody.

Lane 1: DYRK4 transfected lysate(57.2 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DYRK4 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart