No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00008797-M02 |
Product name: | TNFRSF10A monoclonal antibody (M02), clone 2E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF10A. |
Clone: | 2E9 |
Isotype: | IgG1 Kappa |
Gene id: | 8797 |
Gene name: | TNFRSF10A |
Gene alias: | APO2|CD261|DR4|MGC9365|TRAILR-1|TRAILR1 |
Gene description: | tumor necrosis factor receptor superfamily, member 10a |
Genbank accession: | BC012866 |
Immunogen: | TNFRSF10A (AAH12866, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSERPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMC |
Protein accession: | AAH12866 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |