No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00008797-M02 |
| Product name: | TNFRSF10A monoclonal antibody (M02), clone 2E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF10A. |
| Clone: | 2E9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8797 |
| Gene name: | TNFRSF10A |
| Gene alias: | APO2|CD261|DR4|MGC9365|TRAILR-1|TRAILR1 |
| Gene description: | tumor necrosis factor receptor superfamily, member 10a |
| Genbank accession: | BC012866 |
| Immunogen: | TNFRSF10A (AAH12866, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSERPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMC |
| Protein accession: | AAH12866 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |