No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00008797-A02 |
Product name: | TNFRSF10A polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TNFRSF10A. |
Gene id: | 8797 |
Gene name: | TNFRSF10A |
Gene alias: | APO2|CD261|DR4|MGC9365|TRAILR-1|TRAILR1 |
Gene description: | tumor necrosis factor receptor superfamily, member 10a |
Genbank accession: | BC012866 |
Immunogen: | TNFRSF10A (AAH12866, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | PSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSERPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMC |
Protein accession: | AAH12866 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | TNFRSF10A polyclonal antibody (A02), Lot # 051115JC01 Western Blot analysis of TNFRSF10A expression in 293 ( Cat # L026V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |