TNFRSF10D polyclonal antibody (A01) View larger

TNFRSF10D polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFRSF10D polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about TNFRSF10D polyclonal antibody (A01)

Brand: Abnova
Reference: H00008793-A01
Product name: TNFRSF10D polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TNFRSF10D.
Gene id: 8793
Gene name: TNFRSF10D
Gene alias: CD264|DCR2|TRAILR4|TRUNDD
Gene description: tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
Genbank accession: NM_003840
Immunogen: TNFRSF10D (NP_003831, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGS
Protein accession: NP_003831
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy TNFRSF10D polyclonal antibody (A01) now

Add to cart