No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00008792-M43 |
| Product name: | TNFRSF11A monoclonal antibody (M43), clone 6D12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF11A. |
| Clone: | 6D12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8792 |
| Gene name: | TNFRSF11A |
| Gene alias: | CD265|FEO|LOH18CR1|ODFR|OFE|OPTB7|OSTS|PDB2|RANK|TRANCER |
| Gene description: | tumor necrosis factor receptor superfamily, member 11a, NFKB activator |
| Genbank accession: | NM_003839.2 |
| Immunogen: | TNFRSF11A (NP_003830.1, 69 a.a. ~ 152 a.a) partial recombinant protein with mouse IgG2a-Fc tag. |
| Immunogen sequence/protein sequence: | IAPPLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCK |
| Protein accession: | NP_003830.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |