No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00008792-M42 |
Product name: | TNFRSF11A monoclonal antibody (M42), clone 2H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF11A. |
Clone: | 2H6 |
Isotype: | IgG1 Kappa |
Gene id: | 8792 |
Gene name: | TNFRSF11A |
Gene alias: | CD265|FEO|LOH18CR1|ODFR|OFE|OPTB7|OSTS|PDB2|RANK|TRANCER |
Gene description: | tumor necrosis factor receptor superfamily, member 11a, NFKB activator |
Genbank accession: | NM_003839.2 |
Immunogen: | TNFRSF11A (NP_003830.1, 69 a.a. ~ 152 a.a) partial recombinant protein with mouse IgG2a-Fc tag. |
Immunogen sequence/protein sequence: | IAPPLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCK |
Protein accession: | NP_003830.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |