| Reference: | H00008784-M11 |
| Product name: | TNFRSF18 monoclonal antibody (M11), clone 3B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF18. |
| Clone: | 3B3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8784 |
| Gene name: | TNFRSF18 |
| Gene alias: | AITR|GITR|GITR-D |
| Gene description: | tumor necrosis factor receptor superfamily, member 18 |
| Genbank accession: | NM_004195 |
| Immunogen: | TNFRSF18 (NP_004186.1, 26 a.a. ~ 161 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAE |
| Protein accession: | NP_004186.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |