Cart 17 Product Products 6 419,83 € (empty)
No products
To be determined Shipping
6 419,83 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 17 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 419,83 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 419,83 €
Data sheet of NAPG monoclonal antibody (M03), clone 4B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about NAPG monoclonal antibody (M03), clone 4B5
| Brand: | Abnova |
| Reference: | H00008774-M03 |
| Product name: | NAPG monoclonal antibody (M03), clone 4B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NAPG. |
| Clone: | 4B5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8774 |
| Gene name: | NAPG |
| Gene alias: | GAMMASNAP |
| Gene description: | N-ethylmaleimide-sensitive factor attachment protein, gamma |
| Genbank accession: | NM_003826 |
| Immunogen: | NAPG (NP_003817.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEK |
| Protein accession: | NP_003817.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NAPG monoclonal antibody (M03), clone 4B5. Western Blot analysis of NAPG expression in HepG2(Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |