Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RIPK2 monoclonal antibody (M02), clone 6F7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about RIPK2 monoclonal antibody (M02), clone 6F7
| Brand: | Abnova |
| Reference: | H00008767-M02 |
| Product name: | RIPK2 monoclonal antibody (M02), clone 6F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RIPK2. |
| Clone: | 6F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8767 |
| Gene name: | RIPK2 |
| Gene alias: | CARD3|CARDIAK|CCK|GIG30|RICK|RIP2 |
| Gene description: | receptor-interacting serine-threonine kinase 2 |
| Genbank accession: | BC004553 |
| Immunogen: | RIPK2 (AAH04553, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM |
| Protein accession: | AAH04553 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | RIPK2 monoclonal antibody (M02), clone 6F7 Western Blot analysis of RIPK2 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Rip2 Is Required for Nod2-Mediated Lysozyme Sorting in Paneth Cells.Wang H, Zhang X, Zuo Z, Zhang Q, Pan Y, Zeng B, Li W, Wei H, Liu Z. J Immunol. 2017 May 1;198(9):3729-3736. doi: 10.4049/jimmunol.1601583. Epub 2017 Mar 22. |