| Brand: | Abnova |
| Reference: | H00008764-M14 |
| Product name: | TNFRSF14 monoclonal antibody (M14), clone 3B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF14. |
| Clone: | 3B2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8764 |
| Gene name: | TNFRSF14 |
| Gene alias: | ATAR|HVEA|HVEM|LIGHTR|TR2 |
| Gene description: | tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) |
| Genbank accession: | BC002794.1 |
| Immunogen: | TNFRSF14 (AAH02794.1, 38 a.a. ~ 200 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | ALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSH |
| Protein accession: | AAH02794.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (20.13 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |