No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00008764-M07 |
Product name: | TNFRSF14 monoclonal antibody (M07), clone 5B5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF14. |
Clone: | 5B5 |
Isotype: | IgG1 Kappa |
Gene id: | 8764 |
Gene name: | TNFRSF14 |
Gene alias: | ATAR|HVEA|HVEM|LIGHTR|TR2 |
Gene description: | tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) |
Genbank accession: | BC002794.1 |
Immunogen: | TNFRSF14 (AAH02794.1, 38 a.a. ~ 200 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | ALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSH |
Protein accession: | AAH02794.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (20.13 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |