Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Tr |
Brand: | Abnova |
Reference: | H00008764-B01P |
Product name: | TNFRSF14 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human TNFRSF14 protein. |
Gene id: | 8764 |
Gene name: | TNFRSF14 |
Gene alias: | ATAR|HVEA|HVEM|LIGHTR|TR2 |
Gene description: | tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) |
Genbank accession: | NM_003820 |
Immunogen: | TNFRSF14 (NP_003811.2, 1 a.a. ~ 283 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH |
Protein accession: | NP_003811.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TNFRSF14 expression in transfected 293T cell line (H00008764-T01) by TNFRSF14 MaxPab polyclonal antibody. Lane 1: TNFRSF14 transfected lysate(31.13 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |