| Brand: | Abnova |
| Reference: | H00008740-H01 |
| Product name: | TNFSF14 (Human) Recombinant Protein |
| Product description: | Purified TNFSF14 (NP_742011.1 89 a.a. - 240 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
| Gene id: | 8740 |
| Gene name: | TNFSF14 |
| Gene alias: | CD258|HVEML|LIGHT|LTg|TR2 |
| Gene description: | tumor necrosis factor (ligand) superfamily, member 14 |
| Genbank accession: | NM_172014.1 |
| Immunogen sequence/protein sequence: | SHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV |
| Protein accession: | NP_742011.1 |
| Form: | Liquid |
| Concentration: | ⥠10 ug/ml |
| Host cell: | Human HEK293T cells |
| Preparation method: | Transfection of pSuper-TNFSF14 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column. |
| Storage buffer: | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | SDS-PAGE and Western Blot |
| Quality control testing picture: |  |
| Tag: | His-Flag-StrepII |
| Product type: | Proteins |
| Host species: | Human |
| Antigen species / target species: | Human |
| Applications: | WB,ELISA,SDS-PAGE,PI |
| Shipping condition: | Dry Ice |