Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EED monoclonal antibody (M05), clone 3B12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about EED monoclonal antibody (M05), clone 3B12
| Brand: | Abnova |
| Reference: | H00008726-M05 |
| Product name: | EED monoclonal antibody (M05), clone 3B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EED. |
| Clone: | 3B12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8726 |
| Gene name: | EED |
| Gene alias: | HEED|WAIT1 |
| Gene description: | embryonic ectoderm development |
| Genbank accession: | NM_003797 |
| Immunogen: | EED (NP_003788.2, 342 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR |
| Protein accession: | NP_003788.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged EED is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Interplay between Homeobox proteins and Polycomb repressive complexes in p16INK4a regulation.Martin N, Popov N, Aguilo F EMBO J. 2013 Mar 1. doi: 10.1038/emboj.2013.37. |