| Brand: | Abnova |
| Reference: | H00008721-M03 |
| Product name: | EDF1 monoclonal antibody (M03), clone 3E6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant EDF1. |
| Clone: | 3E6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8721 |
| Gene name: | EDF1 |
| Gene alias: | EDF-1|MBF1|MGC9058 |
| Gene description: | endothelial differentiation-related factor 1 |
| Genbank accession: | BC015500 |
| Immunogen: | EDF1 (AAH15500.1, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQSRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK |
| Protein accession: | AAH15500.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.02 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | EDF1 monoclonal antibody (M03), clone 3E6. Western Blot analysis of EDF1 expression in Hela S3 NE(Cat # L013V3 ). |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |