No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00008718-M07 |
Product name: | TNFRSF25 monoclonal antibody (M07), clone 1H2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF25. |
Clone: | 1H2 |
Isotype: | IgG2a Kappa |
Gene id: | 8718 |
Gene name: | TNFRSF25 |
Gene alias: | APO-3|DDR3|DR3|LARD|TNFRSF12|TR3|TRAMP|WSL-1|WSL-LR |
Gene description: | tumor necrosis factor receptor superfamily, member 25 |
Genbank accession: | NM_003790 |
Immunogen: | TNFRSF25 (NP_003781, 28 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVE |
Protein accession: | NP_003781 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | TNFRSF25 monoclonal antibody (M07), clone 1H2. Western Blot analysis of TNFRSF25 expression in K-562(Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |