Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TRADD monoclonal antibody (M03), clone 3G3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,IP |
More info about TRADD monoclonal antibody (M03), clone 3G3
| Brand: | Abnova |
| Reference: | H00008717-M03 |
| Product name: | TRADD monoclonal antibody (M03), clone 3G3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRADD. |
| Clone: | 3G3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8717 |
| Gene name: | TRADD |
| Gene alias: | Hs.89862|MGC11078 |
| Gene description: | TNFRSF1A-associated via death domain |
| Genbank accession: | NM_003789 |
| Immunogen: | TRADD (NP_003780, 203 a.a. ~ 312 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA |
| Protein accession: | NP_003780 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of TRADD transfected lysate using anti-TRADD monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TRADD MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |