Brand: | Abnova |
Reference: | H00008707-M02 |
Product name: | B3GALT2 monoclonal antibody (M02), clone 3A6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant B3GALT2. |
Clone: | 3A6 |
Isotype: | IgG2a Kappa |
Gene id: | 8707 |
Gene name: | B3GALT2 |
Gene alias: | BETA3GALT2|GLCT2|beta3Gal-T2 |
Gene description: | UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 |
Genbank accession: | NM_003783 |
Immunogen: | B3GALT2 (NP_003774, 324 a.a. ~ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AEKIFKVSLGIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH |
Protein accession: | NP_003774 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged B3GALT2 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |