No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00008676-M01 |
Product name: | STX11 monoclonal antibody (M01), clone 4F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STX11. |
Clone: | 4F9 |
Isotype: | IgG2a Kappa |
Gene id: | 8676 |
Gene name: | STX11 |
Gene alias: | FHL4|HLH4|HPLH4 |
Gene description: | syntaxin 11 |
Genbank accession: | NM_003764 |
Immunogen: | STX11 (NP_003755, 11 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LSKQYDQQFPDGDDEFDSPHEDIVFETDHILESLYRDIRDIQDENQLLVADVKRLGKQNARFLTSMRRLSSIKRDTNSIAKAIKARGEVIHCKLRAMK |
Protein accession: | NP_003755 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of STX11 expression in transfected 293T cell line by STX11 monoclonal antibody (M01), clone 4F9. Lane 1: STX11 transfected lysate (Predicted MW: 33.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |