Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EIF3S10 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about EIF3S10 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00008661-A01 |
| Product name: | EIF3S10 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant EIF3S10. |
| Gene id: | 8661 |
| Gene name: | EIF3A |
| Gene alias: | EIF3|EIF3S10|KIAA0139|P167|TIF32|eIF3-p170|eIF3-theta|p180|p185 |
| Gene description: | eukaryotic translation initiation factor 3, subunit A |
| Genbank accession: | NM_003750 |
| Immunogen: | EIF3S10 (NP_003741, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYK |
| Protein accession: | NP_003741 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.36 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Interferon-dependent engagement of eukaryotic initiation factor 4B (eIF4B) via S6K- and RSK-mediated signals.Kroczynska B, Kaur S, Katsoulidis E, Majchrzak-Kita B, Sassano A, Kozma SC, Fish EN, Platanias LC. Mol Cell Biol. 2009 May;29(10):2865-75. Epub 2009 Mar 16. |