| Brand: | Abnova |
| Reference: | H00008654-M01 |
| Product name: | PDE5A monoclonal antibody (M01), clone 9H5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PDE5A. |
| Clone: | 9H5 |
| Isotype: | IgG3 Kappa |
| Gene id: | 8654 |
| Gene name: | PDE5A |
| Gene alias: | CGB-PDE|CN5A|PDE5|PDE5A1 |
| Gene description: | phosphodiesterase 5A, cGMP-specific |
| Genbank accession: | NM_001083 |
| Immunogen: | PDE5A (NP_001074, 29 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSVPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTP |
| Protein accession: | NP_001074 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PDE5A is 1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Effects and mechanisms of action of sildenafil citrate in human chorionic arteries.Maharaj CH, O'Toole D, Lynch T, Carney J, Jarman J, Higgins BD, Morrison JJ, Laffey JG. Reprod Biol Endocrinol. 2009 Apr 23;7:34. |