| Brand: | Abnova |
| Reference: | H00008653-M01 |
| Product name: | DDX3Y monoclonal antibody (M01), clone 2D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DDX3Y. |
| Clone: | 2D7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8653 |
| Gene name: | DDX3Y |
| Gene alias: | DBY |
| Gene description: | DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked |
| Genbank accession: | NM_004660 |
| Immunogen: | DDX3Y (NP_004651, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYSSFGSRDSRGK |
| Protein accession: | NP_004651 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.54 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to DDX3Y on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |