No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
| Brand: | Abnova |
| Reference: | H00008644-D01P |
| Product name: | AKR1C3 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human AKR1C3 protein. |
| Gene id: | 8644 |
| Gene name: | AKR1C3 |
| Gene alias: | DD3|DDX|HA1753|HAKRB|HAKRe|HSD17B5|KIAA0119|hluPGFS |
| Gene description: | aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) |
| Genbank accession: | NM_003739.4 |
| Immunogen: | AKR1C3 (NP_003730.4, 1 a.a. ~ 323 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY |
| Protein accession: | NP_003730.4 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of AKR1C3 expression in transfected 293T cell line (H00008644-T03) by AKR1C3 MaxPab polyclonal antibody. Lane 1: AKR1C3 transfected lysate(36.90 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Interindividual Variability in the Cardiac Expression of Anthracycline Reductases in Donors With and Without Down Syndrome.Quinones-Lombrana A, Ferguson D, Hageman Blair R, Kalabus JL, Redzematovic A, Blanco JG Pharm Res. 2014 Feb 22. |