| Brand: | Abnova |
| Reference: | H00008644-B01 |
| Product name: | AKR1C3 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human AKR1C3 protein. |
| Gene id: | 8644 |
| Gene name: | AKR1C3 |
| Gene alias: | DD3|DDX|HA1753|HAKRB|HAKRe|HSD17B5|KIAA0119|hluPGFS |
| Gene description: | aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) |
| Genbank accession: | BC001479 |
| Immunogen: | AKR1C3 (AAH01479, 1 a.a. ~ 323 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY |
| Protein accession: | AAH01479 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | AKR1C3 MaxPab polyclonal antibody. Western Blot analysis of AKR1C3 expression in human liver. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |