Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AOC3 monoclonal antibody (M06), clone 4B8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA |
More info about AOC3 monoclonal antibody (M06), clone 4B8
| Brand: | Abnova |
| Reference: | H00008639-M06 |
| Product name: | AOC3 monoclonal antibody (M06), clone 4B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AOC3. |
| Clone: | 4B8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8639 |
| Gene name: | AOC3 |
| Gene alias: | HPAO|SSAO|VAP-1|VAP1 |
| Gene description: | amine oxidase, copper containing 3 (vascular adhesion protein 1) |
| Genbank accession: | NM_003734 |
| Immunogen: | AOC3 (NP_003725, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSH |
| Protein accession: | NP_003725 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged AOC3 is 0.3 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Alteration of pancreatic carcinoma and promyeloblastic cell adhesion in liver microvasculature by co-culture of hepatocytes, hepatic stellate cells and endothelial cells in a physiologically-relevant model.Danoy M, Shinohara M, Rizki-Safitri A, Collard D, Senez V, Sakai Y. Integr Biol (Camb). 2017 Apr 18;9(4):350-361. Epub 2017 Mar 21. |