No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00008621-M02 |
Product name: | CDC2L5 monoclonal antibody (M02), clone 3G1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDC2L5. |
Clone: | 3G1 |
Isotype: | IgG2a kappa |
Gene id: | 8621 |
Gene name: | CDC2L5 |
Gene alias: | CDC2L|CHED|FLJ35215|KIAA1791 |
Gene description: | cell division cycle 2-like 5 (cholinesterase-related cell division controller) |
Genbank accession: | BC001274 |
Immunogen: | CDC2L5 (AAH01274, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDK |
Protein accession: | AAH01274 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CDC2L5 expression in transfected 293T cell line by CDC2L5 monoclonal antibody (M02), clone 3G1. Lane 1: CDC2L5 transfected lysate(37 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |