Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDC2L5 monoclonal antibody (M02), clone 3G1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about CDC2L5 monoclonal antibody (M02), clone 3G1
| Brand: | Abnova |
| Reference: | H00008621-M02 |
| Product name: | CDC2L5 monoclonal antibody (M02), clone 3G1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDC2L5. |
| Clone: | 3G1 |
| Isotype: | IgG2a kappa |
| Gene id: | 8621 |
| Gene name: | CDC2L5 |
| Gene alias: | CDC2L|CHED|FLJ35215|KIAA1791 |
| Gene description: | cell division cycle 2-like 5 (cholinesterase-related cell division controller) |
| Genbank accession: | BC001274 |
| Immunogen: | CDC2L5 (AAH01274, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDK |
| Protein accession: | AAH01274 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CDC2L5 expression in transfected 293T cell line by CDC2L5 monoclonal antibody (M02), clone 3G1. Lane 1: CDC2L5 transfected lysate(37 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |