PPAP2A purified MaxPab rabbit polyclonal antibody (D01P) View larger

PPAP2A purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPAP2A purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about PPAP2A purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00008611-D01P
Product name: PPAP2A purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human PPAP2A protein.
Gene id: 8611
Gene name: PPAP2A
Gene alias: LLP1a|LPP1|PAP-2a|PAP2|PAP2a2|PAP2alpha2|PAPalpha1
Gene description: phosphatidic acid phosphatase type 2A
Genbank accession: NM_003711
Immunogen: PPAP2A (NP_003702.2, 1 a.a. ~ 284 a.a) full-length human protein.
Immunogen sequence/protein sequence: MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
Protein accession: NP_003702.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00008611-D01P-13-15-1.jpg
Application image note: Western Blot analysis of PPAP2A expression in transfected 293T cell line (H00008611-T02) by PPAP2A MaxPab polyclonal antibody.

Lane 1: PPAP2A transfected lysate(32.20 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PPAP2A purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart