Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KLF7 monoclonal antibody (M01), clone 3E8-B8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about KLF7 monoclonal antibody (M01), clone 3E8-B8
| Brand: | Abnova |
| Reference: | H00008609-M01 |
| Product name: | KLF7 monoclonal antibody (M01), clone 3E8-B8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant KLF7. |
| Clone: | 3E8-B8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8609 |
| Gene name: | KLF7 |
| Gene alias: | UKLF |
| Gene description: | Kruppel-like factor 7 (ubiquitous) |
| Genbank accession: | BC012919 |
| Immunogen: | KLF7 (AAH12919, 1 a.a. ~ 230 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVRSLISAHGRDVSGVLHEAMSSRGTTGNTQVQSPSNATTATGVFPGLTILPST |
| Protein accession: | AAH12919 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (51.04 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | KLF7 monoclonal antibody (M01), clone 3E8-B8 Western Blot analysis of KLF7 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Transcription factor KLF7 regulates differentiation of neuroectodermal and mesodermal cell lineages.Caiazzo M, Colucci-D'Amato L, Esposito MT, Parisi S, Stifani S, Ramirez F, di Porzio U. Exp. Cell. Res. (2010), doi:10.1016/ j.yexcr.2010.05.021 |