| Brand: | Abnova |
| Reference: | H00008600-M22 |
| Product name: | TNFSF11 monoclonal antibody (M22), clone 1D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFSF11. |
| Clone: | 1D8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8600 |
| Gene name: | TNFSF11 |
| Gene alias: | CD254|ODF|OPGL|OPTB2|RANKL|TRANCE|hRANKL2|sOdf |
| Gene description: | tumor necrosis factor (ligand) superfamily, member 11 |
| Genbank accession: | BC074890.1 |
| Immunogen: | TNFSF11 (AAH74890.1, 158 a.a. ~ 317 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | SKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWGKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID |
| Protein accession: | AAH74890.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (19.8 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |