| Brand: | Abnova |
| Reference: | H00008581-B03P |
| Product name: | LY6D purified MaxPab mouse polyclonal antibody (B03P) |
| Product description: | Mouse polyclonal antibody raised against a partial human LY6D protein. |
| Gene id: | 8581 |
| Gene name: | LY6D |
| Gene alias: | E48 |
| Gene description: | lymphocyte antigen 6 complex, locus D |
| Genbank accession: | BC031330 |
| Immunogen: | LY6D (AAH31330, 21 a.a. ~ 128 a.a) partial human protein. |
| Immunogen sequence/protein sequence: | LRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL |
| Protein accession: | AAH31330 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LY6D MaxPab polyclonal antibody. Western Blot analysis of LY6D expression in A-431. |
| Applications: | WB-Ce,WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |