| Brand: | Abnova |
| Reference: | H00008570-M01 |
| Product name: | KHSRP monoclonal antibody (M01), clone 4C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KHSRP. |
| Clone: | 4C10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8570 |
| Gene name: | KHSRP |
| Gene alias: | FBP2|FUBP2|KSRP|MGC99676 |
| Gene description: | KH-type splicing regulatory protein |
| Genbank accession: | NM_003685 |
| Immunogen: | KHSRP (NP_003676, 151 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIM |
| Protein accession: | NP_003676 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to KHSRP on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |