Cart 29 Product Products 8 890,75 € (empty)
No products
265,00 € DAP Shipping
9 155,75 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 29 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 8 890,75 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 9 155,75 €
Data sheet of PDXK monoclonal antibody (M03), clone 4G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PDXK monoclonal antibody (M03), clone 4G6
| Brand: | Abnova |
| Reference: | H00008566-M03 |
| Product name: | PDXK monoclonal antibody (M03), clone 4G6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PDXK. |
| Clone: | 4G6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8566 |
| Gene name: | PDXK |
| Gene alias: | C21orf124|C21orf97|DKFZp566A071|FLJ31940|FLJ37311|MGC15873|MGC31754|MGC52346|PKH|PNK|PRED79 |
| Gene description: | pyridoxal (pyridoxine, vitamin B6) kinase |
| Genbank accession: | BC000123 |
| Immunogen: | PDXK (AAH00123, 1 a.a. ~ 312 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL |
| Protein accession: | AAH00123 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (60.06 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PDXK expression in transfected 293T cell line by PDXK monoclonal antibody (M03), clone 4G6. Lane 1: PDXK transfected lysate(35.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |