Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PDXK polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about PDXK polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00008566-A01 |
| Product name: | PDXK polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PDXK. |
| Gene id: | 8566 |
| Gene name: | PDXK |
| Gene alias: | C21orf124|C21orf97|DKFZp566A071|FLJ31940|FLJ37311|MGC15873|MGC31754|MGC52346|PKH|PNK|PRED79 |
| Gene description: | pyridoxal (pyridoxine, vitamin B6) kinase |
| Genbank accession: | NM_003681 |
| Immunogen: | PDXK (NP_003672, 51 a.a. ~ 160 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | HWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGR |
| Protein accession: | NP_003672 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PDXK polyclonal antibody (A01), Lot # 061103JCS1 Western Blot analysis of PDXK expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Long-term prednisolone treatments increase bioactive vitamin B6 synthesis in vivo.Chang HY, Tzen JT, Lin SJ, Wu YT, Chiang EP. J Pharmacol Exp Ther. 2010 Dec 28. [Epub ahead of print] |