Brand: | Abnova |
Reference: | H00008565-M02A |
Product name: | YARS monoclonal antibody (M02A), clone 2F3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant YARS. |
Clone: | 2F3 |
Isotype: | IgG1 Kappa |
Gene id: | 8565 |
Gene name: | YARS |
Gene alias: | CMTDIC|TYRRS|YRS|YTS |
Gene description: | tyrosyl-tRNA synthetase |
Genbank accession: | BC001933 |
Immunogen: | YARS (AAH01933, 1 a.a. ~ 528 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS |
Protein accession: | AAH01933 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (83.82 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | YARS monoclonal antibody (M02A), clone 2F3 Western Blot analysis of YARS expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |
Publications: | Dominant mutations in the tyrosyl-tRNA synthetase gene recapitulate in Drosophila features of human Charcot-Marie-Tooth neuropathy.Storkebaum E, Leitao-Goncalves R, Godenschwege T, Nangle L, Mejia M, Bosmans I, Ooms T, Jacobs A, Van Dijck P, Yang XL, Schimmel P, Norga K, Timmerman V, Callaerts P, Jordanova A. Proc Natl Acad Sci U S A. 2009 Jul 14;106(28):11782-7. Epub 2009 Jun 26. |