| Brand: | Abnova |
| Reference: | H00008560-M04 |
| Product name: | DEGS1 monoclonal antibody (M04), clone 2E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DEGS1. |
| Clone: | 2E9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8560 |
| Gene name: | DEGS1 |
| Gene alias: | DEGS|DES1|Des-1|FADS7|MGC5079|MIG15|MLD |
| Gene description: | degenerative spermatocyte homolog 1, lipid desaturase (Drosophila) |
| Genbank accession: | NM_003676 |
| Immunogen: | DEGS1 (NP_003667, 226 a.a. ~ 323 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE |
| Protein accession: | NP_003667 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DEGS1 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |