| Brand: | Abnova |
| Reference: | H00008556-M02 |
| Product name: | CDC14A monoclonal antibody (M02), clone 1F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDC14A. |
| Clone: | 1F11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8556 |
| Gene name: | CDC14A |
| Gene alias: | cdc14|hCDC14 |
| Gene description: | CDC14 cell division cycle 14 homolog A (S. cerevisiae) |
| Genbank accession: | NM_003672 |
| Immunogen: | CDC14A (NP_003663, 431 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSRLASSLGNLNAATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPE |
| Protein accession: | NP_003663 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to CDC14A on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |