Brand: | Abnova |
Reference: | H00008555-D01P |
Product name: | CDC14B purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CDC14B protein. |
Gene id: | 8555 |
Gene name: | CDC14B |
Gene alias: | CDC14B3|Cdc14B1|Cdc14B2|hCDC14B |
Gene description: | CDC14 cell division cycle 14 homolog B (S. cerevisiae) |
Genbank accession: | ENST00000265659 |
Immunogen: | CDC14B (ENSP00000265659, 1 a.a. ~ 471 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTDGWLSQAVTFLDRLLIWLGIHKD |
Protein accession: | ENSP00000265659 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CDC14B MaxPab rabbit polyclonal antibody. Western Blot analysis of CDC14B expression in human liver. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |