No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,PLA-Ce |
Brand: | Abnova |
Reference: | H00008554-M06 |
Product name: | PIAS1 monoclonal antibody (M06), clone 4A4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PIAS1. |
Clone: | 4A4 |
Isotype: | IgG2b Kappa |
Gene id: | 8554 |
Gene name: | PIAS1 |
Gene alias: | DDXBP1|GBP|GU/RH-II|MGC141878|MGC141879|ZMIZ3 |
Gene description: | protein inhibitor of activated STAT, 1 |
Genbank accession: | NM_016166 |
Immunogen: | PIAS1 (NP_057250, 543 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD |
Protein accession: | NP_057250 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged PIAS1 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |