No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00008547-D01P |
| Product name: | FCN3 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human FCN3 protein. |
| Gene id: | 8547 |
| Gene name: | FCN3 |
| Gene alias: | FCNH|HAKA1|MGC22543 |
| Gene description: | ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen) |
| Genbank accession: | NM_173452.1 |
| Immunogen: | FCN3 (AAH20731.1, 1 a.a. ~ 288 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR |
| Protein accession: | AAH20731.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of FCN3 expression in transfected 293T cell line (H00008547-T02) by FCN3 MaxPab polyclonal antibody. Lane 1: FCN3 transfected lysate(31.70 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |