Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00008547-D01P |
Product name: | FCN3 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human FCN3 protein. |
Gene id: | 8547 |
Gene name: | FCN3 |
Gene alias: | FCNH|HAKA1|MGC22543 |
Gene description: | ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen) |
Genbank accession: | NM_173452.1 |
Immunogen: | FCN3 (AAH20731.1, 1 a.a. ~ 288 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR |
Protein accession: | AAH20731.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FCN3 expression in transfected 293T cell line (H00008547-T02) by FCN3 MaxPab polyclonal antibody. Lane 1: FCN3 transfected lysate(31.70 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |